Structure of PDB 7r6q Chain m Binding Site BS02

Receptor Information
>7r6q Chain m (length=180) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SINPYEPLIDWFTRHEEVMPLTAVPEPKRRFVPSKNEAKRVMKIVRAIRE
GRIIPPKKLKEMKEKEKIENYQYDLWGDSTETNDHVMHLRAPKLPPPTNE
ESYNPPEEYLLSPEEKEAWENTEYSERERNFIPQKYSALRKVPGYGESIR
ERFERSLDLYLAPRVRKNKLNIDPNSLIPE
Ligand information
>7r6q Chain 2 (length=57) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugaacgcacauugcgccccuugguauuccagggggcaugccuguuugagc
gucauuu
.....<<<...>>><<<<<<<<<....>>>>>>>>>..............
.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7r6q Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
Resolution2.98 Å
Binding residue
(original residue number in PDB)		V321 M322
Binding residue
(residue number reindexed from 1)		V86 M87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0043021 ribonucleoprotein complex binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor
GO:0070545 PeBoW complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r6q, PDBe:7r6q, PDBj:7r6q
PDBsum7r6q
PubMed36482249
UniProtQ04660|ERB1_YEAST Ribosome biogenesis protein ERB1 (Gene Name=ERB1)

[Back to BioLiP]