Structure of PDB 7q0r Chain m Binding Site BS02

Receptor Information
>7q0r Chain m (length=292) Species: 237561 (Candida albicans SC5314) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQKEFRTSAYHSRFQTPFRRRQEGKTDYYQRKRLVTQHKAKYNSPKYRLV
VRFTNKDIIAQIVSAHITGDVVFTAAYAHELPRYGIKYGLTNWSAAYAVG
LLVARRALQKLGLDETYTGVEEVEGEFELTEAVEDGPRPFKVFLDIGLQR
TTTGARVFGVLKGASDGGLYVPHSPNRFPGWDIEAEELDAELLRKYIFGG
HVAEYMEELLDDDEEKYKSIFKNYIEEEIESEDVEEIYANAHEAIRADPS
FKPTEKKFTKEQYKAESKKYRQQKLTRAERQAKVAKKIAEFK
Ligand information
>7q0r Chain 3 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuagcagaaagcaccguuccccguucgaucaaccgu
aguuaagcugcuaagagcaauaccgaguaguguagugggagaccauacgc
gaaacuauugugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7q0r E-site drug specificity of the human pathogen Candida albicans ribosome.
Resolution2.67 Å
Binding residue
(original residue number in PDB)		R8 S10 H13 S14 F16 T18 F20 R21 R22 Q24 T28 Y30 R33 R50 V52 R54 T56 N57 I61 Q63 I69 T70 G71 D72 V74 Y79 G91 N94 W95 R152 T154 T155 G156 A157 R158 Y198 H203 V204 Y207 K218 S221 I222 N225 F253 P255 T256 F260 K262 Y265 K266 E268 S269 Y272 R273 Q274 K276 L277 R279 R282 K285 K289
Binding residue
(residue number reindexed from 1)		R6 S8 H11 S12 F14 T16 F18 R19 R20 Q22 T26 Y28 R31 R48 V50 R52 T54 N55 I59 Q61 I67 T68 G69 D70 V72 Y77 G89 N92 W93 R150 T152 T153 G154 A155 R156 Y196 H201 V202 Y205 K216 S219 I220 N223 F251 P253 T254 F258 K260 Y263 K264 E266 S267 Y270 R271 Q272 K274 L275 R277 R280 K283 K287
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7q0r, PDBe:7q0r, PDBj:7q0r
PDBsum7q0r
PubMed35613268
UniProtQ5AGZ7|RL5_CANAL Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]