Structure of PDB 6hhq Chain m Binding Site BS02

Receptor Information
>6hhq Chain m (length=296) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRL
VVRFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYAT
GLLIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQ
RTTTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFG
GHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADP
AFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ
Ligand information
>6hhq Chain 3 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hhq Understanding the role of intermolecular interactions between lissoclimides and the eukaryotic ribosome.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		A2 K8 S10 S13 S14 F16 T18 F20 R21 R22 R24 T28 Y30 R33 R50 R54 T56 N57 K58 I61 Q63 I69 T70 D72 V74 G91 R152 T154 T155 A157 R158 Y198 H203 V204 Y207 E210 R218 E221 L222 K224 Y226 F253 T256 F260 K262 Q264 Y265 A266 E268 S269 Y272 Q274 K276 L277 K279 R282 R285 V286
Binding residue
(residue number reindexed from 1)		A1 K7 S9 S12 S13 F15 T17 F19 R20 R21 R23 T27 Y29 R32 R49 R53 T55 N56 K57 I60 Q62 I68 T69 D71 V73 G90 R151 T153 T154 A156 R157 Y197 H202 V203 Y206 E209 R217 E220 L221 K223 Y225 F252 T255 F259 K261 Q263 Y264 A265 E267 S268 Y271 Q273 K275 L276 K278 R281 R284 V285
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6hhq, PDBe:6hhq, PDBj:6hhq
PDBsum6hhq
PubMed30759226
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]