Structure of PDB 4pjo Chain m Binding Site BS02

Receptor Information
>4pjo Chain m (length=50) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLID
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pjo ?
Resolution3.3 Å
Binding residue
(original residue number in PDB)		T11 Y12 T14 H24 R28
Binding residue
(residue number reindexed from 1)		T10 Y11 T13 H23 R27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding
Biological Process
GO:0000387 spliceosomal snRNP assembly
GO:0000398 mRNA splicing, via spliceosome
Cellular Component
GO:0005634 nucleus
GO:0005685 U1 snRNP

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4pjo, PDBe:4pjo, PDBj:4pjo
PDBsum4pjo
PubMed25555158
UniProtP09234|RU1C_HUMAN U1 small nuclear ribonucleoprotein C (Gene Name=SNRPC)

[Back to BioLiP]