Structure of PDB 5obm Chain l5 Binding Site BS02

Receptor Information
>5obm Chain l5 (length=294) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVV
RFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGL
LIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRT
TTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGGH
VSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADPAF
KPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ
Ligand information
>5obm Chain 7 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5obm Aminoglycoside interactions and impacts on the eukaryotic ribosome.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		K8 S10 S13 S14 T18 F20 R21 R22 R24 T28 Y30 R33 R50 V52 R54 T56 N57 Q63 I65 I69 T70 D72 V73 V74 Y79 G91 N94 W95 Q151 R152 T154 T155 G156 R158 Y198 H203 V204 Y207 R218 E221 L222 F253 T256 K258 K259 F260 K262 Y265 A266 E268 S269 K270 K271 Y272 Q274 K276 L277 K279 R282 R285 K289
Binding residue
(residue number reindexed from 1)		K5 S7 S10 S11 T15 F17 R18 R19 R21 T25 Y27 R30 R47 V49 R51 T53 N54 Q60 I62 I66 T67 D69 V70 V71 Y76 G88 N91 W92 Q148 R149 T151 T152 G153 R155 Y195 H200 V201 Y204 R215 E218 L219 F250 T253 K255 K256 F257 K259 Y262 A263 E265 S266 K267 K268 Y269 Q271 K273 L274 K276 R279 R282 K286
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5obm, PDBe:5obm, PDBj:5obm
PDBsum5obm
PubMed29208708
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]