Structure of PDB 6hcm Chain l3 Binding Site BS02

Receptor Information
>6hcm Chain l3 (length=50) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSHKTFRIKRFLAKKQKQNRPIPQWIWMKTGNKIRYNSKRRHWRRTKLGL
Ligand information
>6hcm Chain 82 (length=151) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagc
uagcugcgagaauuaaugugaauugcagguugaucaucgacacuucgaac
gcacuugcggccccggguuccucccggggcuacgccugucugagcgucgc
u
.........................................<<<<<<.<<
.....>>>.....(.<<<......>>........>>>..)...>>>....
<<<..>>><<<<<<<<.......>>>>>>>>...................
.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6hcm ZNF598 Is a Quality Control Sensor of Collided Ribosomes.
Resolution6.8 Å
Binding residue
(original residue number in PDB)		K15 R21 I23 W26 M29 I35
Binding residue
(residue number reindexed from 1)		K14 R20 I22 W25 M28 I34
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6hcm, PDBe:6hcm, PDBj:6hcm
PDBsum6hcm
PubMed30293783
UniProtG1TTN1

[Back to BioLiP]