Structure of PDB 7r81 Chain l1 Binding Site BS02

Receptor Information
>7r81 Chain l1 (length=88) Species: 5141 (Neurospora crassa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKGTSSFGKRHTKTHGLCRRCGRRSLHNQKKVCASCGYPAAKTRKYNWSE
KAKRRKTTGTGRLRYLSTVSRKFKNGFQTGVPKGSKGP
Ligand information
>7r81 Chain C1 (length=158) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucuggcaucgaugaagaacgcagc
gaaaugcgauagguaaugugaauugcagaauucagugaaucaucgaaucu
uugaacgcacauugcgcucgccaguauucuggcgagcaugccuguucgag
cgucauuu
.........................................<<<<<<<<<
....>>>>.....<.<<<......>>..............>>>..>...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide
Resolution2.7 Å
Binding residue
(original residue number in PDB)
R21 C22 G23 A42 T59 G62 R63 L64 R65 Y66 L67 V70 R72 F74 K75 N76 Q79 T80 G81 P83 S86 K87
Binding residue
(residue number reindexed from 1)
R20 C21 G22 A41 T58 G61 R62 L63 R64 Y65 L66 V69 R71 F73 K74 N75 Q78 T79 G80 P82 S85 K86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7r81, PDBe:7r81, PDBj:7r81
PDBsum7r81
PubMed34815343
UniProtV5IQ48

[Back to BioLiP]