Structure of PDB 7oyb Chain l1 Binding Site BS02

Receptor Information
>7oyb Chain l1 (length=49) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASHKTFRIKRFLAKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWRRTKLG
Ligand information
>7oyb Chain 81 (length=150) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagcu
agcugcgagaacuaaugugaauugcaggacagaucaucgaccuuucgaac
gcacauugcggccccggguaucccggggccacgccugucugagggucgcc
........................................<<<<<<<((.
...>>>>.......<<<......)).........>>>......>>>....
<<.....>><<<<<<<<<...>>>>>>>>>....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oyb A molecular network of conserved factors keeps ribosomes dormant in the egg.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		T6 F7 R8 R11 K15 K18 Q19 R21 I23 W26 I27 M29 I35 K40
Binding residue
(residue number reindexed from 1)		T5 F6 R7 R10 K14 K17 Q18 R20 I22 W25 I26 M28 I34 K39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oyb, PDBe:7oyb, PDBj:7oyb
PDBsum7oyb
PubMed36653451
UniProtQ6IMW8

[Back to BioLiP]