Structure of PDB 8bf9 Chain l Binding Site BS02

Receptor Information
>8bf9 Chain l (length=47) Species: 9940 (Ovis aries) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HKTFRIKRFLAKKQKQNRPIPQWIRMKTGNKIRYNKRRHWRRTKLGL
Ligand information
>8bf9 Chain 8 (length=98) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucggcucgugcgucgaugaagaacgcagcagcugcgagaauuaaugugaa
uugcaggacacauugauuucgcacuugcggccccgggccggggcuacg
....................<<<<<<<((...>>>>..............
..)).............>>><<....>><<<<<<<<.>>>>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bf9 Molecular view of ER membrane remodeling by the Sec61/TRAP translocon.
Resolution2.69 Å
Binding residue
(original residue number in PDB)		F7 K15 K18 Q19 R21 I23 P24 W26 M29 K30 T31 I35 K40
Binding residue
(residue number reindexed from 1)		F4 K12 K15 Q16 R18 I20 P21 W23 M26 K27 T28 I32 K36
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bf9, PDBe:8bf9, PDBj:8bf9
PDBsum8bf9
PubMed37983950
UniProtA0A6P3TG10

[Back to BioLiP]