Structure of PDB 7tm3 Chain l Binding Site BS02

Receptor Information
>7tm3 Chain l (length=50) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSHKTFRIKRFLAKKQKQNRPIPQWIWMKTGNKIRYNSKRRHWRRTKLGL
Ligand information
>7tm3 Chain v (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagc
uagcugcgagaauuaaugugaauugcaggacacauugaucaucgacacuu
cgaacgcacuugcggccccggguuccucccggggcuacgccugucugagc
gucgcu
.........................................<<<<<<<<<
....>>>>.....<.<<<......>>.............>>>..>...>>
>....<<<..>>><<<<<<<<.......>>>>>>>>..............
......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tm3 Mechanism of an intramembrane chaperone for multipass membrane proteins.
Resolution3.25 Å
Binding residue
(original residue number in PDB)
R11 K15 K18 Q19 R21 I23 P24 W26 M29 K30 T31 I35 K40
Binding residue
(residue number reindexed from 1)
R10 K14 K17 Q18 R20 I22 P23 W25 M28 K29 T30 I34 K39
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7tm3, PDBe:7tm3, PDBj:7tm3
PDBsum7tm3
PubMed36261528
UniProtG1TTN1

[Back to BioLiP]