Structure of PDB 7qiw Chain l Binding Site BS02

Receptor Information

>7qiw Chain l (length=87) Species: 4081 (Solanum lycopersicum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAYPAARLRSYNWSV
KAIRRKTTGTGRMRYLRNVPRRFKTNFREGTEAAPRK

Ligand information

>7qiw Chain 8 (length=159) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aacgacucucggcaacggauaucucggcucucgcaucgaugaagaacgua
gcgaaaugcgauacuuggugugaauugcagaaucccgugaaccaucgagu
cuuugaacgcaaguugcgcccgaagccauggccgagggcacgucugccug
ggcgucacg

...........................................<<<<<<.
((.....>>>.....<<<<<......))..............>>>>.>..
.>>>....<<.....>><<<<...<<<..>>>...>>>>...........
.........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7qiw Cryo-EM structure and rRNA modification sites of a plant ribosome.
Resolution	2.35 Å
Binding residue (original residue number in PDB)	R21 C22 G23 L29 A42 T59 G60 G62 R63 M64 R65 Y66 L67 R68 R72 F74 T76 F78 R79 E80 G81 T82 E83 A84 R87
Binding residue (residue number reindexed from 1)	R20 C21 G22 L28 A41 T58 G59 G61 R62 M63 R64 Y65 L66 R67 R71 F73 T75 F77 R78 E79 G80 T81 E82 A83 R86

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7qiw, PDBe:7qiw, PDBj:7qiw
PDBsum	7qiw
PubMed	35643637
UniProt	A0A3Q7FV98

[Back to BioLiP]