Structure of PDB 7e82 Chain l Binding Site BS02

Receptor Information
>7e82 Chain l (length=106) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKKV
MVAVDLLYRVPDQPSLDGNTVDMDRERTQFADNSLKYQMGLTVLGSQLKG
MMNVLQ
Ligand information
>7e82 Chain 6 (length=21) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GVPGALSNQPAPPNEAPIATP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7e82 Structural basis of assembly and torque transmission of the bacterial flagellar motor.
Resolution3.3 Å
Binding residue
(original residue number in PDB)
D42 L86 Y87 R88 V89 S94
Binding residue
(residue number reindexed from 1)
D40 L57 Y58 R59 V60 S65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0071973 bacterial-type flagellum-dependent cell motility
GO:0071978 bacterial-type flagellum-dependent swarming motility
Cellular Component
GO:0009288 bacterial-type flagellum
GO:0009425 bacterial-type flagellum basal body
GO:0030694 bacterial-type flagellum basal body, rod

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7e82, PDBe:7e82, PDBj:7e82
PDBsum7e82
PubMed33882274
UniProtP16437|FLGB_SALTY Flagellar basal body rod protein FlgB (Gene Name=flgB)

[Back to BioLiP]