Structure of PDB 5z3g Chain l Binding Site BS02

Receptor Information
>5z3g Chain l (length=117) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPSLPKIKTVRKSIA
CVLTVINEQQREAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASQVTE
KQRKKQIAFPQRKYAIK
Ligand information
>5z3g Chain B (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgccccuugguauuccagggggcaugccuguuugag
cgucau
.........................................<<<<<<.<<
.....>>>.....(.<<<(.....>>............).>>>..)...>
>>....<<<...>>><<<<<<<<<....>>>>>>>>>.............
......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5z3g Cryo-EM structure of an early precursor of large ribosomal subunit reveals a half-assembled intermediate.
Resolution3.65 Å
Binding residue
(original residue number in PDB)		K5 Y7 R10 P39 S40 R48 K49 A52 C53 L55 T56 N59 R63 T85 R86 R89
Binding residue
(residue number reindexed from 1)		K3 Y5 R8 P37 S38 R46 K47 A50 C51 L53 T54 N57 R61 T83 R84 R87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5z3g, PDBe:5z3g, PDBj:5z3g
PDBsum5z3g
PubMed29557065
UniProtP0CX84|RL35A_YEAST Large ribosomal subunit protein uL29A (Gene Name=RPL35A)

[Back to BioLiP]