Structure of PDB 5lzu Chain l Binding Site BS02

Receptor Information

>5lzu Chain l (length=50) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SSHKTFRIKRFLAKKQKQNRPIPQWIWMKTGNKIRYNSKRRHWRRTKLGL

Ligand information

>5lzu Chain 8 (length=151) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagc
uagcugcgagaauuaaugugaauugcagguugaucaucgacacuucgaac
gcacuugcggccccggguuccucccggggcuacgccugucugagcgucgc
u

.........................................<<<<<<<<<
....>>>>.....<.<<<......>>........>>>..>...>>>....
<<<..>>><<<<<<<<.......>>>>>>>>...................
.

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5lzu Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.
Resolution	3.75 Å
Binding residue (original residue number in PDB)	T6 F7 K15 K18 Q19 I23 W26 M29 K30 T31 I35 N38 K40
Binding residue (residue number reindexed from 1)	T5 F6 K14 K17 Q18 I22 W25 M28 K29 T30 I34 N37 K39

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5lzu, PDBe:5lzu, PDBj:5lzu
PDBsum	5lzu
PubMed	27863242
UniProt	G1TTN1

[Back to BioLiP]