Structure of PDB 7qv1 Chain k Binding Site BS02

Receptor Information
>7qv1 Chain k (length=118) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKKNIESGIAHIRSTFNNTIVTITDTHGNAISWSSAGALGFRGSRKSTPF
AAQMAAETAAKGSIEHGLKTLEVTVKGPGSGREAAIRALQAAGLEVTAIR
DVTPVPHNGCRPPKRRRV
Ligand information
>7qv1 Chain A (length=26) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aauaaaugaugcagacaguacuagau
..........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qv1 Bacterial ribosome collision sensing by a MutS DNA repair ATPase paralogue.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		F29 S93
Binding residue
(residue number reindexed from 1)		F16 S80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qv1, PDBe:7qv1, PDBj:7qv1
PDBsum7qv1
PubMed35264791
UniProtP04969|RS11_BACSU Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]