Structure of PDB 7cgo Chain k Binding Site BS02

Receptor Information
>7cgo Chain k (length=108) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDRLDAALRFQQEALNLRAQRQEILAANIANADTPGYQARDIDFASELKK
VMVRAVDLLYRVPDQPSLDGNTVDMDRERTQFADNSLKYQMGLTVLGSQL
KGMMNVLQ
Ligand information
>7cgo Chain 5 (length=21) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GVPGALSNQPAPPNEAPIATP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cgo Structural basis of assembly and torque transmission of the bacterial flagellar motor.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		Y87 V89 P90 S94
Binding residue
(residue number reindexed from 1)		Y60 V62 P63 S67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0071973 bacterial-type flagellum-dependent cell motility
GO:0071978 bacterial-type flagellum-dependent swarming motility
Cellular Component
GO:0009288 bacterial-type flagellum
GO:0009425 bacterial-type flagellum basal body
GO:0030694 bacterial-type flagellum basal body, rod

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7cgo, PDBe:7cgo, PDBj:7cgo
PDBsum7cgo
PubMed33882274
UniProtP16437|FLGB_SALTY Flagellar basal body rod protein FlgB (Gene Name=flgB)

[Back to BioLiP]