Structure of PDB 6v3a Chain k Binding Site BS02

Receptor Information
>6v3a Chain k (length=117) Species: 1310678 (Acinetobacter sp. 263903-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRTVSEGVAHIHASFNNTIVTITDRQGNALAWATSGGQGFRGSRKSTPFA
AQVAAEVAGKAALDYGLKNLDVLVKGPGPGRESAVRALGAVGYKINSITD
VTPIPHNGCRPPKKRRV
Ligand information
>6v3a Chain u (length=21) Species: 1310678 (Acinetobacter sp. 263903-1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KREFYEKPTQERKRKKAAAVK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6v3a Cryo-electron Microscopy Structure of the Acinetobacter baumannii 70S Ribosome and Implications for New Antibiotic Development.
Resolution2.82 Å
Binding residue
(original residue number in PDB)		R121 P122 P123 K124
Binding residue
(residue number reindexed from 1)		R110 P111 P112 K113
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6v3a, PDBe:6v3a, PDBj:6v3a
PDBsum6v3a
PubMed31964740
UniProtA0A062C259

[Back to BioLiP]