Structure of PDB 5imr Chain k Binding Site BS02

Receptor Information

>5imr Chain k (length=110) Species: 300852 (Thermus thermophilus HB8)

RLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVSAS
SLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKALA
EGAREGGLEF

Ligand information

>5imr Chain E (length=123)

aaucccccgugcccauagcggcguggaaccacccguucccauuccgaaca
cggaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccugg
gagaguaggucggugcgggggau

...<<<<<<<<<.....<<<<<<<<.....<<<<<...............
>>>..>>....>>>>>>.>><<<...<...<<<<<<<<....>>>>>>>>
.....>.>>>..>>>>>>>>>..

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5imr Structure of the GTP Form of Elongation Factor 4 (EF4) Bound to the Ribosome
• Resolution: 5.7 Å
• Binding residue (original residue number in PDB): R17 R25 F29 L32 K33 H34 Q38 V46 T47 G60 N61 K62 T63 Y92 H95 G96 R97
• Binding residue (residue number reindexed from 1): R15 R23 F27 L30 K31 H32 Q36 V44 T45 G58 N59 K60 T61 Y90 H93 G94 R95

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5imr, PDBe:5imr, PDBj:5imr
• PDBsum: 5imr
• PubMed: 27137929
• UniProt: Q5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)