Structure of PDB 7oyc Chain j1 Binding Site BS02

Receptor Information
>7oyc Chain j1 (length=86) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKGTSSFGKRRNKTHSLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSA
KAKRRNTTGTGRMRHLKVVYRRFKNGFREGTTPKPK
Ligand information
>7oyc Chain 81 (length=147) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagcu
agcugcgagaauuagugugaauugcaggacagaucaucgacacuucgaac
gcaccuugcggccccgggcccggggccacgccugucugagggucgcu
........................................<<<<<<.<<.
....>>>.....(.<<<......>>.........>>>..)...>>>....
<<.....>><<<<<<<<<>>>>>>>>>....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oyc A molecular network of conserved factors keeps ribosomes dormant in the egg.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R20 R21 C22 Y27 L29 Y39 N57 T59 G60 G62 R63 M64 R65 H66 L67 V70 Y71 R72 F74 R79 E80 T82 T83 P84 K85 K87
Binding residue
(residue number reindexed from 1)		R19 R20 C21 Y26 L28 Y38 N56 T58 G59 G61 R62 M63 R64 H65 L66 V69 Y70 R71 F73 R78 E79 T81 T82 P83 K84 K86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oyc, PDBe:7oyc, PDBj:7oyc
PDBsum7oyc
PubMed36653451
UniProtA0A1L8I2F1

[Back to BioLiP]