Structure of PDB 7oya Chain j1 Binding Site BS02

Receptor Information

>7oya Chain j1 (length=86) Species: 7955 (Danio rerio)

TKGTSSFGKRRNKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSA
KAKRRSTTGTGRMRHMKVVFRRFRNGFREGTVPKPR

Ligand information

>7oya Chain 81 (length=158)

aacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagcu
agcugcgagaacuaaugugaauugcaggacacacauugaucaucgaccuu
ucgaacgcacauugcggccccggguccaucccggggccacgccugucuga
gggucgcc

........................................<<<<<<.<..
....>>>.....(.<<<.......>...............>>>..)...>
>>....<<.....>><<<<<<<<<.....>>>>>>>>>............
........

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7oya A molecular network of conserved factors keeps ribosomes dormant in the egg.
• Resolution: 3.2 Å
• Binding residue (original residue number in PDB): R20 R21 C22 G23 Y27 L29 Y39 T59 G60 G62 R63 M64 R65 H66 M67 V70 F71 R72 F74 N76 R79 T82 V83 P84 K85 P86 R87
• Binding residue (residue number reindexed from 1): R19 R20 C21 G22 Y26 L28 Y38 T58 G59 G61 R62 M63 R64 H65 M66 V69 F70 R71 F73 N75 R78 T81 V82 P83 K84 P85 R86

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation
• GO:0032981 mitochondrial respiratory chain complex I assembly
• GO:0033617 mitochondrial cytochrome c oxidase assembly

Cellular Component

• GO:0005743 mitochondrial inner membrane
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7oya, PDBe:7oya, PDBj:7oya
• PDBsum: 7oya
• PubMed: 36653451
• UniProt: Q6IQJ7