Structure of PDB 8ovj Chain j Binding Site BS02

Receptor Information

>8ovj Chain j (length=81) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TKGTTSMGQRHGRTHILCRRCGRNSYHVQWERCAACAYPRASRRRYNWSV
KAIKRRRTGTGRCRYLKVVNRRIANHFKTPK

Ligand information

>8ovj Chain 7 (length=164) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aacgugucgcgauggaugacuuggcuuccuauuucguugaagaacgcagu
aaagugcgauaagugguaucaauugcagaacauucaauuaccgaaucuuu
gaacgcaaacggcgcaugggagaagcucgugucauccccgugcaugccau
auucucagugucga

.........................................<<<<<<.((
.....>>>.....<<<<<......))............>>>>.>...>>>
....<<.....>><<<<<<<....<<....>>....>>>>>>>.......
..............

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	R20 R21 C22 R44 T59 G62 R63 C64 R65 Y66 L67 R72 R73 N76 H77 K79 T80 P81
Binding residue (residue number reindexed from 1)	R19 R20 C21 R43 T58 G61 R62 C63 R64 Y65 L66 R71 R72 N75 H76 K78 T79 P80

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ovj, PDBe:8ovj, PDBj:8ovj
PDBsum	8ovj
PubMed	38722744
UniProt	E9AEH2

[Back to BioLiP]