Structure of PDB 8ev3 Chain j Binding Site BS02

Receptor Information

>8ev3 Chain j (length=71) Species: 4896 (Schizosaccharomyces pombe)

KSHTICRRCGKRSFHIQKSTCACCGYPAAKTRSYNWGAKAKRRRTTGTGR
MSYLKKVHRSFKNGFRSGKPA

Ligand information

>8ev3 Chain 2 (length=150)

aaaacuuucagcaacggaucucuuggcucucgcaucgaugaagaacgcag
cgaaaugcgauacguaaugugaauugcagaagaaucaucgaaucuuugaa
cgcacugcgccuuuggguucuaccaaaggcaugccuguuugagugucauu

..........................................<<<<<<<<
.....>>>>.....<.<<<.......>........>>>..>...>>>...
.<<...>><<<<<<<<......>>>>>>>>....................

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8ev3 Chromatin localization of nucleophosmin organizes ribosome biogenesis.
• Resolution: 3.0 Å
• Binding residue (original residue number in PDB): R20 R21 C22 G23 Y39 T59 G60 G62 R63 M64 Y66 L67 H71 F74 K75 N76 F78 R79 S80 G81 P83
• Binding residue (residue number reindexed from 1): R7 R8 C9 G10 Y26 T46 G47 G49 R50 M51 Y53 L54 H58 F61 K62 N63 F65 R66 S67 G68 P70

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ev3, PDBe:8ev3, PDBj:8ev3
• PDBsum: 8ev3
• PubMed: 36423630
• UniProt: P05733|RL37B_SCHPO Large ribosomal subunit protein eL37B (Gene Name=rpl3702)