Structure of PDB 8etc Chain j Binding Site BS02

Receptor Information

>8etc Chain j (length=75) Species: 4896 (Schizosaccharomyces pombe)

MRHNKSHTICRRCGKRSFHIQKSTCACCGYPAAKTRSYNWGAKAKRRRTT
GTGRMSYLKKVHRSFKNGFRSGKPA

Ligand information

>8etc Chain 2 (length=147)

aaaacuuucagcaacggaucucuuggcucucgcaucgaugaagaacgcag
cgaaaugcgauacguaaugugaauugcagaagaaucaucgaaucuuugaa
cgcacauugcgccuuugggaccaaaggcaugccuguuugagugucau

..........................................<<<<<<.<
<.....>>>.....(.<<<(.....>>......).>>>..)...>>>...
.<<.....>><<<<<<<<..>>>>>>>>...................

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8etc Chromatin localization of nucleophosmin organizes ribosome biogenesis.
• Resolution: 3.1 Å
• Binding residue (original residue number in PDB): R20 R21 C22 G23 I29 Y39 T59 G62 R63 M64 Y66 L67 H71 R72 F74 N76 R79 S80 G81 P83
• Binding residue (residue number reindexed from 1): R11 R12 C13 G14 I20 Y30 T50 G53 R54 M55 Y57 L58 H62 R63 F65 N67 R70 S71 G72 P74

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8etc, PDBe:8etc, PDBj:8etc
• PDBsum: 8etc
• PubMed: 36423630
• UniProt: P05733|RL37B_SCHPO Large ribosomal subunit protein eL37B (Gene Name=rpl3702)