Structure of PDB 8esq Chain j Binding Site BS02

Receptor Information
>8esq Chain j (length=71) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSHTICRRCGKRSFHIQKSTCACCGYPAAKTRSYNWGAKAKRRRTTGTGR
MSYLKKVHRSFKNGFRSGKPA
Ligand information
>8esq Chain 2 (length=150) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaaacuuucagcaacggaucucuuggcucucgcaucgaugaagaacgcag
cgaaaugcgauacguaaugugaauugcagaagaaucaucgaaucuuugaa
cgcacugcgccuuuggguucuaccaaaggcaugccuguuugagugucauu
..........................................<<<<<<.<
<.....>>>.....(.<<<......>>........>>>..)...>>>...
.<<<.>>><<<<<<<<......>>>>>>>>....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8esq Chromatin localization of nucleophosmin organizes ribosome biogenesis.
Resolution2.8 Å
Binding residue
(original residue number in PDB)
R20 R21 C22 G23 Y39 A42 T59 G60 G62 R63 M64 Y66 L67 H71 R72 F74 K75 N76 F78 R79 S80 G81 K82 P83
Binding residue
(residue number reindexed from 1)
R7 R8 C9 G10 Y26 A29 T46 G47 G49 R50 M51 Y53 L54 H58 R59 F61 K62 N63 F65 R66 S67 G68 K69 P70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8esq, PDBe:8esq, PDBj:8esq
PDBsum8esq
PubMed36423630
UniProtP05733|RL37B_SCHPO Large ribosomal subunit protein eL37B (Gene Name=rpl3702)

[Back to BioLiP]