Structure of PDB 8bf9 Chain j Binding Site BS02

Receptor Information
>8bf9 Chain j (length=73) Species: 9940 (Ovis aries) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKGTSSFGKRRNKTHTLCRRCGSKCPAKRKRKYNWSAKAKRRNTTGTGRM
RHLKIVYRRFRHGFREGTTPKPK
Ligand information
>8bf9 Chain 8 (length=98) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucggcucgugcgucgaugaagaacgcagcagcugcgagaauuaaugugaa
uugcaggacacauugauuucgcacuugcggccccgggccggggcuacg
....................<<<<<<<((...>>>>..............
..)).............>>><<....>><<<<<<<<.>>>>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bf9 Molecular view of ER membrane remodeling by the Sec61/TRAP translocon.
Resolution2.69 Å
Binding residue
(original residue number in PDB)		R20 R21 C22 G23 T59 G60 G62 M64 H66 L67 V70 Y71 F74 F78 P84 K85 K87
Binding residue
(residue number reindexed from 1)		R19 R20 C21 G22 T45 G46 G48 M50 H52 L53 V56 Y57 F60 F64 P70 K71 K73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bf9, PDBe:8bf9, PDBj:8bf9
PDBsum8bf9
PubMed37983950
UniProtW5P472

[Back to BioLiP]