Structure of PDB 8azw Chain j Binding Site BS02

Receptor Information

>8azw Chain j (length=154) Species: 4097 (Nicotiana tabacum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VKYSKEPDNPTKSCKARGSSLRVHFKNTRETAHALRKMPLDKAKRYLEDV
LAHKQAIPFTRFCRGVGRTAQAKNRHSSGQGRWPVKSTKFILDLLKNAES
NADVKGLDVDLLFISHIQVNQAQKQRRRTYRAHGRINPYMSHPCHIELTL
SEKE

Ligand information

>8azw Chain B (length=163) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaacgacucucggcaacggauaucucggcucucgcaucgaugaagaacgu
agcgaaaugcgauacuuggugugaauugcagaauuccgugaaccaucgag
ucuuugaacgcaaguugcgcccgaagccauuaggccgagggcacgucugc
cugggcgucacgc

............................................<<<<<<
.((.....>>>....<<<<<<<.....))............>.>>>>.>>
..>>>....<<.....>><<<<...<<......>>...>>>>........
.............

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8azw Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.
Resolution	2.14 Å
Binding residue (original residue number in PDB)	K3 S5 R37 T61 R62 N121 Q122 H146
Binding residue (residue number reindexed from 1)	K2 S4 R36 T60 R61 N120 Q121 H145

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8azw, PDBe:8azw, PDBj:8azw
PDBsum	8azw
PubMed	37156858
UniProt	A0A1S4CCH0

[Back to BioLiP]