Structure of PDB 7qiz Chain j Binding Site BS02

Receptor Information

>7qiz Chain j (length=122) Species: 4081 (Solanum lycopersicum)

ARIKVHELRNKSKTELLAQLKDLKAELALLRVAKVTGGAPNKLSKIKVVR
LSIAQVLTVISQKQKAALREVYKNKKYLPLDLRPKKTRAIRKRLTKHQSS
LKTEREKKKEMYFPLRKYAIKV

Ligand information

>7qiz Chain 8 (length=159)

aacgacucucggcaacggauaucucggcucucgcaucgaugaagaacgua
gcgaaaugcgauacuuggugugaauugcagaaucccgugaaccaucgagu
cuuugaacgcaaguugcgcccgaagccauggccgagggcacgucugccug
ggcgucacg

...........................................<<<<<<.
((.....>>>.....<<<<<......))..............>>>>.>..
.>>>....<<.....>><<<<...<<<..>>>...>>>>...........
.........

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7qiz Specific features and methylation sites of a plant ribosome
• Resolution: 2.38 Å
• Binding residue (original residue number in PDB): H7 R10 K35 N42 S45 R51 A55 Q56 L58 T59 S62 Q63 K66 R70 P85 K86 T88 R89 R92
• Binding residue (residue number reindexed from 1): H6 R9 K34 N41 S44 R50 A54 Q55 L57 T58 S61 Q62 K65 R69 P84 K85 T87 R88 R91

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7qiz, PDBe:7qiz, PDBj:7qiz
• PDBsum: 7qiz
• PubMed: 35643637
• UniProt: Q53U38