Structure of PDB 7pwg Chain j Binding Site BS02

Receptor Information
>7pwg Chain j (length=87) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKGTASFGKRHTRIHGSCRRCGKHSFHLQKHECASCGYPSAKMRRYNWSY
KSLRRRTQGTGSMSHMRKVYRAYNSGTLKANARKYLA
Ligand information
>7pwg Chain 4 (length=138) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaacgccccgccggcggaugccucggcccgggcggcgacgaagagcgcgg
cggagcgcgagacgcggugcggacccgcccgccccgagaagcaccgaccc
ucgaacgcagcgcgcccggcgccgccgccucggcgccc
..........................................<<<<<<.(
(.....>>>.....<<<<<<...<..))..>.........>>>>>>...>
>>....<<...>><<...>>..................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pwg Cryo-EM structure of the ancient eukaryotic ribosome from the human parasite Giardia lamblia.
Resolution2.75 Å
Binding residue
(original residue number in PDB)		R20 R21 C22 G23 Q59 G60 G62 M64 H66 M67 R68 V70 Y71 R72 Y74 G77 T78
Binding residue
(residue number reindexed from 1)		R19 R20 C21 G22 Q58 G59 G61 M63 H65 M66 R67 V69 Y70 R71 Y73 G76 T77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pwg, PDBe:7pwg, PDBj:7pwg
PDBsum7pwg
PubMed35100413
UniProtA8BLV7

[Back to BioLiP]