Structure of PDB 7ohv Chain j Binding Site BS02

Receptor Information
>7ohv Chain j (length=73) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGAKAKRRHTTGTGR
MRYLKHVSRRFKNGFQTGSASKA
Ligand information
>7ohv Chain 2 (length=155) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacgcgccccuugguauuccagggggcaugccuguuugagcgu
cauuu
.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<..>><<<<<<<<<....>>>>>>>>>................
.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ohv Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		R21 C22 G23 T59 G62 R63 M64 R65 Y66 K68 V70 R72 F74 N76 F78 Q79 T80 G81 A83 K85
Binding residue
(residue number reindexed from 1)		R8 C9 G10 T46 G49 R50 M51 R52 Y53 K55 V57 R59 F61 N63 F65 Q66 T67 G68 A70 K72
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:0044391 ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ohv, PDBe:7ohv, PDBj:7ohv
PDBsum7ohv
PubMed34813592
UniProtP49166|RL37A_YEAST Large ribosomal subunit protein eL37A (Gene Name=RPL37A)

[Back to BioLiP]