Structure of PDB 7d1t Chain j Binding Site BS02

Receptor Information

>7d1t Chain j (length=36) Species: 32053 (Thermostichus vulcanus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL

Ligand information

InChI=1S/Mg/q+2

JLVVSXFLKOJNIY-UHFFFAOYSA-N

SMILES

Software	SMILES
ACDLabs 10.04 OpenEye OEToolkits 1.5.0	[Mg+2]
CACTVS 3.341	[Mg++]

Formula

Mg

Name

MAGNESIUM ION

PDB chain

7d1t Chain j Residue 101 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7d1t High-resolution cryo-EM structure of photosystem II reveals damage from high-dose electron beams.
Resolution	1.95 Å
Binding residue (original residue number in PDB)	G31 A34 L36
Binding residue (residue number reindexed from 1)	G27 A30 L32
Annotation score	4

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009523	photosystem II
GO:0009539	photosystem II reaction center
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7d1t, PDBe:7d1t, PDBj:7d1t
PDBsum	7d1t
PubMed	33753866
UniProt	Q7DGD4\|PSBJ_THEVL Photosystem II reaction center protein J (Gene Name=psbJ)

[Back to BioLiP]