Structure of PDB 6ys5 Chain j Binding Site BS02

Receptor Information
>6ys5 Chain j (length=127) Species: 575584 (Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATNYGTGRRKTATARVFLSAGTGKLVINNRTLEQYFGRETARMVVRQPLE
LLEATEKYDLYITVKGGGIGGQAGAIRHGITRALIAADETLKPVLRQAGF
VTRDAREVERKKLGLRKARKRPQFSKR
Ligand information
>6ys5 Chain 7 (length=20) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucgggcucauaacccgaag
.<<<<<.......>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ys5 Structure of the 70S Ribosome from the Human Pathogen Acinetobacter baumannii in Complex with Clinically Relevant Antibiotics.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		K127 R128
Binding residue
(residue number reindexed from 1)		K126 R127
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ys5, PDBe:6ys5, PDBj:6ys5
PDBsum6ys5
PubMed32857965
UniProtD0CG36

[Back to BioLiP]