Structure of PDB 6em3 Chain j Binding Site BS02

Receptor Information

>6em3 Chain j (length=71) Species: 559292 (Saccharomyces cerevisiae S288C)

SHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGAKAKRRHTTGTGRM
RYLKHVSRRFKNGFQTGSASK

Ligand information

>6em3 Chain 2 (length=157)

aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgccccuugguauuccagggggcaugccuguuugag
cgucauu

.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<.....>><<<<<<<<......>>>>>>>>.............
.......

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6em3 Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
• Resolution: 3.2 Å
• Binding residue (original residue number in PDB): R21 C22 G23 T59 G60 G62 M64 R65 Y66 L67 G81
• Binding residue (residue number reindexed from 1): R7 C8 G9 T45 G46 G48 M50 R51 Y52 L53 G67

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:0044391 ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6em3, PDBe:6em3, PDBj:6em3
• PDBsum: 6em3
• PubMed: 29245012
• UniProt: P49166|RL37A_YEAST Large ribosomal subunit protein eL37A (Gene Name=RPL37A)