Structure of PDB 8ekc Chain i Binding Site BS02

Receptor Information
>8ekc Chain i (length=127) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLE
LVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGF
VTRDARQVERKKVGLRKARRRPQFSKR
Ligand information
>8ekc Chain x (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcgggguggagcagccugguagcucgucgggcucauaacccgaaggucgu
cgguucaaauccggcccccgcaacca
<<<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<<
<<<.......>>>>>>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ekc Insights into the molecular mechanism of translation inhibition by the ribosome-targeting antibiotic thermorubin.
Resolution2.7 Å
Binding residue
(original residue number in PDB)
K129 R130
Binding residue
(residue number reindexed from 1)
K126 R127
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8ekc, PDBe:8ekc, PDBj:8ekc
PDBsum8ekc
PubMed36546783
UniProtP0A7X3|RS9_ECOLI Small ribosomal subunit protein uS9 (Gene Name=rpsI)

[Back to BioLiP]