Structure of PDB 6ysr Chain i Binding Site BS02

Receptor Information
>6ysr Chain i (length=127) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLE
LVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGF
VTRDARQVERKKVGLRKARRRPQFSKR
Ligand information
>6ysr Chain w (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcccggauagcucagucgguagagcaggggauugaaaauccccguguccu
cgguucgauuccgaguccgggcacca
<<<<<<<..<<<<........>>>><<<<<<<.....>>>>>>.>...<<
<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ysr Mechanism of ribosome rescue by alternative ribosome-rescue factor B.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		K128 R129
Binding residue
(residue number reindexed from 1)		K126 R127
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ysr, PDBe:6ysr, PDBj:6ysr
PDBsum6ysr
PubMed32796827
UniProtC3SRY2

[Back to BioLiP]