Structure of PDB 6wd2 Chain i Binding Site BS02

Receptor Information

>6wd2 Chain i (length=141) Species: 562 (Escherichia coli)

AKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEK
GLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKI
SRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED

Ligand information

>6wd2 Chain 7 (length=76)

gcccggauagcucagucgguagagcaggggauugaaaauccccguguccu
ugguucgauuccgaguccgggcacca

<<<<<<<..<<<<........>>>>.<<<<<<.....>>>>>>.....<<
<<<.......>>>>>>>>>>>>....

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6wd2 Cryo-EM of elongating ribosome with EF-Tu•GTP elucidates tRNA proofreading.
• Resolution: 3.6 Å
• Binding residue (original residue number in PDB): P21 P25
• Binding residue (residue number reindexed from 1): P21 P25

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding
• GO:0070180 large ribosomal subunit rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006415 translational termination
• GO:0015968 stringent response

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6wd2, PDBe:6wd2, PDBj:6wd2
• PDBsum: 6wd2
• PubMed: 32612237
• UniProt: P0A7J7|RL11_ECOLI Large ribosomal subunit protein uL11 (Gene Name=rplK)