Structure of PDB 3jd5 Chain i Binding Site BS02

Receptor Information
>3jd5 Chain i (length=98) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSEYALRMSRLSARLFSEVARPTDSKSMKVVKLFSEQPLAKRKETYDWYP
NHNTYFALMGILRSVGLYRDEHQDFKDEQLRLKKLRGKVKPRKGEGKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jd5 Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
Resolution7.0 Å
Binding residue
(original residue number in PDB)		R10 R17 R24
Binding residue
(residue number reindexed from 1)		R7 R14 R21
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Cellular Component
External links
PDB RCSB:3jd5, PDBe:3jd5, PDBj:3jd5
PDBsum3jd5
PubMed24799711
UniProtP82926|RT33_BOVIN Small ribosomal subunit protein mS33 (Gene Name=MRPS33)

[Back to BioLiP]