Structure of PDB 8eti Chain h Binding Site BS02

Receptor Information
>8eti Chain h (length=120) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LKTFELRKQSQENLAEQLQELRQELASLRVQKIAGGSGSKLSKIKTTRKD
IARILTVINESNRLAAREAYKNKKYIPLDLRQKKTRAIRRALTPYEQSRK
TLKQIKKERYFPLRKYALKA
Ligand information
>8eti Chain 2 (length=152) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucagcaacggaucucuuggcucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugcagaaugaaucaucgaaucuuugaa
cgcacauugcgccuuuggguucuaccaaaggcaugccuguuugaguguca
uu
.........................................<<<<<<<<<
....>>>>.....<.<<<......>>.........>>>..>...>>>...
.<<<...>>><<<<<<<<......>>>>>>>>..................
..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8eti Chromatin localization of nucleophosmin organizes ribosome biogenesis.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		T5 R9 S41 L43 S44 R50 K51 A54 R55 L57 T58 N61 E62 R65 L80 R83 Q84 K85 T87 R88 R91
Binding residue
(residue number reindexed from 1)		T3 R7 S39 L41 S42 R48 K49 A52 R53 L55 T56 N59 E60 R63 L78 R81 Q82 K83 T85 R86 R89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8eti, PDBe:8eti, PDBj:8eti
PDBsum8eti
PubMed36423630
UniProtO74904|RL35_SCHPO Large ribosomal subunit protein uL29 (Gene Name=rpl35)

[Back to BioLiP]