Structure of PDB 8b6c Chain h Binding Site BS02

Receptor Information

>8b6c Chain h (length=122) Species: 9986 (Oryctolagus cuniculus)

AKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVR
KSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEES
LKTKKQQRKERLYPLRKYAVKA

Ligand information

>8b6c Chain 8 (length=151)

cgacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagc
uagcugcgagaauuaaugugaauugcagguugaucaucgacacuucgaac
gcacuugcggccccggguuccucccggggcuacgccugucugagcgucgc
u

.........................................<<<<<<<<<
....>>>>.....<.<<<......>>........>>>..>...>>>....
<<<..>>><<<<<<<<.......>>>>>>>>...................
.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8b6c Structural insights into TRAP association with ribosome-Sec61 complex and translocon inhibition by a CADA derivative.
• Resolution: 2.79 Å
• Binding residue (original residue number in PDB): K5 R7 R10 K46 R48 R51 K52 A55 R56 L58 T59 N62 Q63 K66 L81 R84 K86 T88 R89 R92
• Binding residue (residue number reindexed from 1): K4 R6 R9 K45 R47 R50 K51 A54 R55 L57 T58 N61 Q62 K65 L80 R83 K85 T87 R88 R91

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8b6c, PDBe:8b6c, PDBj:8b6c
• PDBsum: 8b6c
• PubMed: 36867692
• UniProt: G1SIT5|RL35_RABIT Large ribosomal subunit protein uL29 (Gene Name=RPL35)