Structure of PDB 6woo Chain h Binding Site BS02

Receptor Information
>6woo Chain h (length=116) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPSLPKIKTVRKSIA
CVLTVINEQQREAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASQVTE
KQRKKQIAFPQRKYAI
Ligand information
>6woo Chain 8 (length=157) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacauugcgccccuugguauuccagggggcaugccuguuugag
cgucauu
.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<.....>><<<<<<<<<....>>>>>>>>>.............
.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6woo An active role of the eukaryotic large ribosomal subunit in translation initiation fidelity.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		Y7 R10 L41 P42 R48 K49 A52 C53 L55 T56 N59 E60 R63 R67 K78 R81 A82 K83 T85 R86 R89
Binding residue
(residue number reindexed from 1)		Y5 R8 L39 P40 R46 K47 A50 C51 L53 T54 N57 E58 R61 R65 K76 R79 A80 K81 T83 R84 R87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6woo, PDBe:6woo, PDBj:6woo
PDBsum6woo
PubMed
UniProtP0CX84|RL35A_YEAST Large ribosomal subunit protein uL29A (Gene Name=RPL35A)

[Back to BioLiP]