Structure of PDB 6tnn Chain h Binding Site BS02

Receptor Information

>6tnn Chain h (length=120) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

MITKTSKNAARLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQIIDDVNG
VTLASASTLDKDLNVESTGDTSAATKVGELVAKRAAEKGISDVVFDRGGY
LYHGRVKALADAAREAGLKF

Ligand information

>6tnn Chain V (length=116)

uuugguggcgauagcgaagaggucacacccguucccauaccgaacacgga
aguuaagcucuucagcgccgaugguagucggggguuucccccugugagag
uaggacgccgccaagc

.<<<<<<<<....<<<<<<<<.....<<.<<...............>>..
.>>....>>>>>>.>>.<<.......<<.<<<<<...>>>>>.>>.....
..>>..>>>>>>>>..

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6tnn Structures of B. subtilis Maturation RNases Captured on 50S Ribosome with Pre-rRNAs.
• Resolution: 3.07 Å
• Binding residue (original residue number in PDB): K7 R11 H15 F34 R35 S36 N37 K38 S55 H103 R105
• Binding residue (residue number reindexed from 1): K7 R11 H15 F34 R35 S36 N37 K38 S55 H103 R105

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006364 rRNA processing
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6tnn, PDBe:6tnn, PDBj:6tnn
• PDBsum: 6tnn
• PubMed: 32991829
• UniProt: P46899|RL18_BACSU Large ribosomal subunit protein uL18 (Gene Name=rplR)