Structure of PDB 5njt Chain h Binding Site BS02

Receptor Information

>5njt Chain h (length=120) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

MITKTSKNAARLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQIIDDVNG
VTLASASTLDKDLNVESTGDTSAATKVGELVAKRAAEKGISDVVFDRGGY
LYHGRVKALADAAREAGLKF

Ligand information

>5njt Chain V (length=112)

ugguggcgauagcgaagaggucacacccguucccauaccgaacacggaag
uuaagcucuucagcgccgaugguagucggggguuucccccugugagagua
ggacgccgccaa

<<<<<<<....<<<<<<<<.....<<<<<<.............>>>>..>
>....>>>>>>.>>.<<.......<<.<<<<<...>>>>>.>>.......
>>..>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5njt Structure of the Bacillus subtilis hibernating 100S ribosome reveals the basis for 70S dimerization.
• Resolution: 3.8 Å
• Binding residue (original residue number in PDB): K4 S6 K7 H15 R19 R30 N32 F34 R35 S36 N37 K38 H39 Q43 G50 V51 T52 S55 D70 T71 Y100 L101 H103 G104 R105
• Binding residue (residue number reindexed from 1): K4 S6 K7 H15 R19 R30 N32 F34 R35 S36 N37 K38 H39 Q43 G50 V51 T52 S55 D70 T71 Y100 L101 H103 G104 R105

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006364 rRNA processing
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5njt, PDBe:5njt, PDBj:5njt
• PDBsum: 5njt
• PubMed: 28468753
• UniProt: P46899|RL18_BACSU Large ribosomal subunit protein uL18 (Gene Name=rplR)