Structure of PDB 5h1s Chain h Binding Site BS02

Receptor Information
>5h1s Chain h (length=46) Species: 3562 (Spinacia oleracea) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSRPQKKGTAHHMKTRPKKTARWDIKRGPAVYPPLPPLPAEWTIVS
Ligand information
>5h1s Chain B (length=117) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uucugguguccuaggcguagaggaaccacaccaauccaucccgaacuugg
ugguuaaacucuacugcggugacgauacuguaggggagguccugcggaaa
aauagcucgacgccagg
..<<<<<<<.....<<<<<<<<.....<<<<<<..............>>>
>.>>....>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>...
....>>>..>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5h1s Cryo-EM structure of the large subunit of the spinach chloroplast ribosome.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		R50 K53 K65
Binding residue
(residue number reindexed from 1)		R3 K6 K18
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0009507 chloroplast
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5h1s, PDBe:5h1s, PDBj:5h1s
PDBsum5h1s
PubMed27762343
UniProtP82411|PSRP6_SPIOL Large ribosomal subunit protein cL38 (Gene Name=PSRP6)

[Back to BioLiP]