Structure of PDB 3jan Chain h Binding Site BS02

Receptor Information
>3jan Chain h (length=122) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKIKARDLRGKKKEELLKQLEDLKVELSQLRVAKVTGGAASKLSKIRVVR
KSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEEN
LKTKKQQRKERLYPLRKFAVKA
Ligand information
>3jan Chain 8 (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagc
uagcugcgagaauuaaugugaauugcaggacacauugaucaucgacacuu
cgaacgcacuugcggccccggguuccucccggggcuacgccugucugagc
gucgcu
.........................................<<<<<<.<<
.....>>>.......<<<......>>.............>>>......>>
>....<<<..>>><<<<<<<<.......>>>>>>>>..............
......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jan Structures of the scanning and engaged states of the mammalian SRP-ribosome complex.
Resolution3.75 Å
Binding residue
(original residue number in PDB)		A2 K5 A6 R7 R10 A41 L44 S45 R48 R51 K52 A55 R56 L58 T59 N62 Q63 K66 R70 L81 R84 P85 T88 R89 R92
Binding residue
(residue number reindexed from 1)		A1 K4 A5 R6 R9 A40 L43 S44 R47 R50 K51 A54 R55 L57 T58 N61 Q62 K65 R69 L80 R83 P84 T87 R88 R91
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 02:53:24 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '3jan', asym_id = 'h', bs = 'BS02', title = 'Structures of the scanning and engaged states of the mammalian SRP-ribosome complex.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='3jan', asym_id='h', bs='BS02', title='Structures of the scanning and engaged states of the mammalian SRP-ribosome complex.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0000463,0003735,0005840,0006412,0022625', uniprot = '', pdbid = '3jan', asym_id = 'h'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000463,0003735,0005840,0006412,0022625', uniprot='', pdbid='3jan', asym_id='h')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>