Structure of PDB 3jag Chain h Binding Site BS02

Receptor Information
>3jag Chain h (length=122) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVR
KSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEES
LKTKKQQRKERLYPLRKYAVKA
Ligand information
>3jag Chain 8 (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagc
uagcugcgagaauuaaugugaauugcaggacacauugaucaucgacacuu
cgaacgcacuugcggccccggguuccucccggggcuacgccugucugagc
gucgcu
.........................................<<<<<<.<<
.....>>>.....(.<<<......>>.............>>>..)...>>
>....<<<..>>><<<<<<<<.......>>>>>>>>..............
......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jag Structural basis for stop codon recognition in eukaryotes.
Resolution3.65 Å
Binding residue
(original residue number in PDB)		A2 K3 K5 A6 R7 A41 L44 S45 R48 R51 K52 A55 R56 L58 T59 N62 Q63 K66 R70 L81 R84 K86 T88 R89 R92
Binding residue
(residue number reindexed from 1)		A1 K2 K4 A5 R6 A40 L43 S44 R47 R50 K51 A54 R55 L57 T58 N61 Q62 K65 R69 L80 R83 K85 T87 R88 R91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jag, PDBe:3jag, PDBj:3jag
PDBsum3jag
PubMed26245381
UniProtG1SIT5|RL35_RABIT Large ribosomal subunit protein uL29 (Gene Name=RPL35)

[Back to BioLiP]