Structure of PDB 3j7q Chain h Binding Site BS02

Receptor Information
>3j7q Chain h (length=122) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKIKARDLRGKKKEELLKQLEDLKVELSQLRVAKVTGGAASKLSKIRVVR
KSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEEN
LKTKKQQRKERLYPLRKFAVKA
Ligand information
>3j7q Chain 8 (length=156) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagc
uagcugcgagaauuaaugugaauugcaggacacauugaucaucgacacuu
cgaacgcacuugcggccccggguuccucccggggcuacgccugucugagc
gucgcu
.........................................<<<<<<.<<
.....>>>.......<<<......>>.............>>>......>>
>....<<<..>>><<<<<<<<.......>>>>>>>>..............
......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3j7q Structure of the Mammalian ribosome-sec61 complex to 3.4 a resolution.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		A2 K5 R7 A41 L44 S45 R48 R51 K52 R56 L58 T59 N62 Q63 K66 R70 L81 R84 P85 K86 T88 R89 R92
Binding residue
(residue number reindexed from 1)		A1 K4 R6 A40 L43 S44 R47 R50 K51 R55 L57 T58 N61 Q62 K65 R69 L80 R83 P84 K85 T87 R88 R91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:0098556 cytoplasmic side of rough endoplasmic reticulum membrane
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j7q, PDBe:3j7q, PDBj:3j7q
PDBsum3j7q
PubMed24930395
UniProtQ29361|RL35_PIG Large ribosomal subunit protein uL29 (Gene Name=RPL35)

[Back to BioLiP]