Structure of PDB 8bpo Chain g2 Binding Site BS02

Receptor Information

>8bpo Chain g2 (length=122) Species: 9986 (Oryctolagus cuniculus)

AKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVR
KSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEES
LKTKKQQRKERLYPLRKYAVKA

Ligand information

>8bpo Chain C1 (length=151)

cgacucuuagcgguggaucacucggcucgugcgucgaugaagaacgcagc
uagcugcgagaauuaaugugaauugcagguugaucaucgacacuucgaac
gcacuugcggccccggguuccucccggggcuacgccugucugagcgucgc
u

.........................................<<<<<<<<<
....>>>>.....<.<<<......>>........>>>..>...>>>....
<<<..>>><<<<<<<<.......>>>>>>>>...................
.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8bpo Mechanism of ribosome-associated mRNA degradation during tubulin autoregulation.
• Resolution: 2.8 Å
• Binding residue (original residue number in PDB): A6 R10 K35 S45 R48 K52 A55 R56 L58 T59 N62 K66 R70 L81 R84 P85 K86 T88 R89 R92
• Binding residue (residue number reindexed from 1): A5 R9 K34 S44 R47 K51 A54 R55 L57 T58 N61 K65 R69 L80 R83 P84 K85 T87 R88 R91

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8bpo, PDBe:8bpo, PDBj:8bpo
• PDBsum: 8bpo
• PubMed: 37295431
• UniProt: G1SIT5|RL35_RABIT Large ribosomal subunit protein uL29 (Gene Name=RPL35)