Structure of PDB 8ow0 Chain g Binding Site BS02

Receptor Information
>8ow0 Chain g (length=97) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILE
LAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNI
Ligand information
>8ow0 Chain E (length=120) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tttaactttcggaaatcaaatacactaatattaaaacgcgggggacagcg
cgtacgtgcgtttaagcggtgctagagctgtctacgaccaattgagcggc
ctcggcaccatgtgacttat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ow0 Cryo-EM structure of the complete inner kinetochore of the budding yeast point centromere.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		Q17 S18 R19 S20 K22 R34
Binding residue
(residue number reindexed from 1)		Q1 S2 R3 S4 K6 R18
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006281 DNA repair
GO:0006325 chromatin organization
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0031298 replication fork protection complex
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ow0, PDBe:8ow0, PDBj:8ow0
PDBsum8ow0
PubMed37506202
UniProtP04911|H2A1_YEAST Histone H2A.1 (Gene Name=HTA1)

[Back to BioLiP]