Structure of PDB 8g7q Chain g Binding Site BS02

Receptor Information
>8g7q Chain g (length=152) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLA
QRSGKSELEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAM
RWIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAF
AH
Ligand information
>8g7q Chain y (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggccccuuagcucagugguuagagcaggcgacucauaaucgcuuggucgc
ugguucaaguccagcaggggccacca
<<<<<.<..<<<<........>>>><<<<<<.......>>>>>>......
<<<.......>>>..>.>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8g7q Structures of the ribosome bound to EF-Tu-isoleucine tRNA elucidate the mechanism of AUG avoidance
Resolution3.1 Å
Binding residue
(original residue number in PDB)		S77 R79 S83 T84 Q86 M144
Binding residue
(residue number reindexed from 1)		S76 R78 S82 T83 Q85 M143
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0015935 small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8g7q, PDBe:8g7q, PDBj:8g7q
PDBsum8g7q
PubMed38538914
UniProtP02359|RS7_ECOLI Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]