Structure of PDB 7msc Chain g Binding Site BS02

Receptor Information
>7msc Chain g (length=155) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRKGPAPKRPLVNDPVYGSQLVTQLVNKVLLKGKKSLAERIVYGALEQAR
DKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLAL
RWLVGYSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRAF
AHYRW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7msc Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
Resolution2.97 Å
Binding residue
(original residue number in PDB)		R79 G82
Binding residue
(residue number reindexed from 1)		R78 G81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7msc, PDBe:7msc, PDBj:7msc
PDBsum7msc
PubMed35064151
UniProtP9WH29|RS7_MYCTU Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]