Structure of PDB 5zep Chain g Binding Site BS02

Receptor Information

>5zep Chain g (length=156) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MPRKGPAPKRPLVNDPVYGSQLVTQLVNKVLLEGKKSLAERIVYGALEQA
REKTGTDPVVTLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVNFSRQRREKTMVERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW

Ligand information

>5zep Chain w (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgcgggguggagcagccugguagcucgucgggcucauaacccgaagaucg
ucgguucaaauccggcccccgcaacca

.<<<<<...<<<<.........>>>>..<<<<.......>>>>......<
<<<<.......>>>>>.>>>>>.....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5zep Structures of Mycobacterium smegmatis 70S ribosomes in complex with HPF, tmRNA, and P-tRNA.
Resolution	3.4 Å
Binding residue (original residue number in PDB)	S77 R79 A83 T84 Q86 K143 M144 A147 N148
Binding residue (residue number reindexed from 1)	S77 R79 A83 T84 Q86 K143 M144 A147 N148

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5zep, PDBe:5zep, PDBj:5zep
PDBsum	5zep
PubMed	30206241
UniProt	A0QS97\|RS7_MYCS2 Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]